PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_14452g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 432aa    MW: 48467.8 Da    PI: 4.4272
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_14452g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-164794148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l ++++ +G   W++ +++ g++R++k+c++rw++yl
    MA_14452g0010 47 RGAWTAEEDSRLSEYIQSHGESGWRSLPKKAGLNRCGKSCRLRWLNYL 94
                     89********************************************97 PP

2Myb_DNA-binding51.91.8e-16100145148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +++E+el+++ +++lG++ W++Ia +++ gRt++++k++w+++l
    MA_14452g0010 100 RGNISPDEEELIIRMHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 145
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8754294IPR017930Myb domain
SuperFamilySSF466891.1E-2745141IPR009057Homeodomain-like
SMARTSM007176.4E-124696IPR001005SANT/Myb domain
PfamPF002491.1E-144794IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2248101IPR009057Homeodomain-like
CDDcd001678.80E-94994No hitNo description
PROSITE profilePS5129426.45595149IPR017930Myb domain
SMARTSM007172.6E-1699147IPR001005SANT/Myb domain
PfamPF002499.2E-15100145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-25102149IPR009057Homeodomain-like
CDDcd001672.46E-12104145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MISEKYQKPA RGSDQPGYKK LGVDASKRIA CIMGRTPCCS KREELNRGAW TAEEDSRLSE  60
YIQSHGESGW RSLPKKAGLN RCGKSCRLRW LNYLRPDIKR GNISPDEEEL IIRMHRLLGN  120
RWSLIAGRLP GRTDNEIKNY WNTHLSKKLT MSSQNPKFPM QAPADPEQSA SSDSSEDDVV  180
RSAEYGVINH SGIRSPPAKI GGTSISARVP PPVASDEVVI MKSWKQLLED SLMNELDDSE  240
DNSSLMGIEL SNDMLESEAP LMEIQNNVSC SASDPNESVY SHGHLVADET SNQRTSESNV  300
LYSQDCNVLS LPPTDHTLDF RIQDFSLESL LQPSVYNLEE ICPVQSQING SDHVSCFALA  360
AEQSMTDIYN NTLEPDWLTP VDYENQSSQP DPMDVLGNFF LSDENWQEEV PTSLSKIQEE  420
EYRDILVDIS NN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-274414924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6765980.0EF676598.1 Picea sitchensis clone WS02743_O08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLG10.0B8LLG1_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-62myb domain protein 7